Product Browser

Last updated: 2014/7/21
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RHOA purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00000387-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human RHOA protein.
  • Immunogen:
  • RHOA (AAH01360.1, 1 a.a. ~ 193 a.a) full-length human protein.
  • Sequence:
  • MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of RHOA expression in transfected 293T cell line (H00000387-T02) by RHOA MaxPab polyclonal antibody.

    Lane 1: RHOA transfected lysate(21.80 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • Proximity Ligation Analysis of protein-protein interactions between RHOA and DAAM1 HeLa cells were stained with anti-RHOA rabbit purified polyclonal 1:1200 and anti-DAAM1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 387
  • Gene Name:
  • RHOA
  • Gene Alias:
  • ARH12,ARHA,RHO12,RHOH12
  • Gene Description:
  • ras homolog gene family, member A
  • Other Designations:
  • Aplysia ras-related homolog 12,oncogene RHO H12,small GTP binding protein RhoA
  • RSS
  • YouTube
  • Linkedin
  • Facebook