ARG1 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
ARG1 MaxPab polyclonal antibody. Western Blot analysis of ARG1 expression in human liver.
Western Blot (Cell lysate)
ARG1 MaxPab polyclonal antibody. Western Blot analysis of ARG1 expression in HepG2.
Western Blot (Transfected lysate)
Western Blot analysis of ARG1 expression in transfected 293T cell line (H00000383-T03) by ARG1 MaxPab polyclonal antibody.
Lane 1: ARG1 transfected lysate(35.42 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ARG1 protein.
Immunogen
ARG1 (AAH20653.1, 1 a.a. ~ 322 a.a) full-length human protein.
Sequence
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87); Rat (87)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ARG1 MaxPab polyclonal antibody. Western Blot analysis of ARG1 expression in human liver.Western Blot (Cell lysate)
ARG1 MaxPab polyclonal antibody. Western Blot analysis of ARG1 expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of ARG1 expression in transfected 293T cell line (H00000383-T03) by ARG1 MaxPab polyclonal antibody.
Lane 1: ARG1 transfected lysate(35.42 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ARG1
Entrez GeneID
383GeneBank Accession#
NM_000045.2Protein Accession#
AAH20653.1Gene Name
ARG1
Gene Alias
-
Gene Description
arginase, liver
Gene Ontology
HyperlinkGene Summary
Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exist (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type I isoform encoded by this gene, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia. [provided by RefSeq
Other Designations
A-I|OTTHUMP00000017209|arginase, type I
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com