APOA2 monoclonal antibody (M01), clone 4F3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant APOA2.
Immunogen
APOA2 (AAH05282, 1 a.a. ~ 100 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (64); Rat (57)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of APOA2 expression in transfected 293T cell line by APOA2 monoclonal antibody (M01), clone 4F3.
Lane 1: APOA2 transfected lysate(11.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to APOA2 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged APOA2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — APOA2
Entrez GeneID
336GeneBank Accession#
BC005282Protein Accession#
AAH05282Gene Name
APOA2
Gene Alias
-
Gene Description
apolipoprotein A-II
Gene Ontology
HyperlinkGene Summary
This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia. [provided by RefSeq
Other Designations
OTTHUMP00000032244
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Cholesterol Uptake Capacity: A New Measure of HDL Functionality for Coronary Risk Assessment.
Amane Harada, Ryuji Toh, Katsuhiro Murakami, Maria Kiriyama, Keiko Yoshikawa, Keiko Miwa, Takuya Kubo, Yasuhiro Irino, Kenta Mori, Nobuaki Tanaka, Kunihiro Nishimura, Tatsuro Ishida, Ken-Ichi Hirata.
The Journal of Applied Laboratory Medicine 2017 Sep; 2(2):186.
Application:WB-Re, Recombinant proteins.
-
Cholesterol Uptake Capacity: A New Measure of HDL Functionality for Coronary Risk Assessment.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com