ANXA11 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ANXA11 full-length ORF ( AAH07564, 1 a.a. - 505 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANMPNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQPPGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYEIKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEEGMLAVVKCLKNTPAFFAERLNKAMRGAGTRDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKICGGND
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
81.29
Interspecies Antigen Sequence
Mouse (93); Rat (94)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ANXA11
Entrez GeneID
311GeneBank Accession#
BC007564Protein Accession#
AAH07564Gene Name
ANXA11
Gene Alias
ANX11, CAP50
Gene Description
annexin A11
Omim ID
602572Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the annexin family, a group of calcium-dependent phospholipid-binding proteins. Annexins have unique N-terminal domains and conserved C-terminal domains, which contain the calcium-dependent phospholipid-binding sites. The encoded protein is a 56-kD antigen recognized by sera from patients with various autoimmune diseases. Transcript variants encoding the same isoform have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000019955|OTTHUMP00000019956|OTTHUMP00000019957|OTTHUMP00000019958|OTTHUMP00000059806|annexin XI|autoantigen, 56-kD|calcyclin-associated annexin 50
-
Interactome
-
Disease
-
Publication Reference
-
Prostate cancer biomarker annexin A3 detected in urines obtained following digital rectal examination presents antigenic variability.
Hamelin-Peyron C, Vlaeminck-Guillem V, Haïdous H, Schwall GP, Poznanović S, Gorius-Gallet E, Michel S, Larue A, Guillotte M, Ruffion A, Choquet-Kastylevsky G, Ataman-Önal Y.
Clinical Biochemistry 2014 Jul; 47(10-11):901.
Application：ELISA, Func, WB-Re, Human, Human urine.
-
Prostate cancer biomarker annexin A3 detected in urines obtained following digital rectal examination presents antigenic variability.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com