BIN1 monoclonal antibody (M03), clone 2C7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant BIN1.
Immunogen
BIN1 (NP_004296, 355 a.a. ~ 454 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (94)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of BIN1 expression in transfected 293T cell line by BIN1 monoclonal antibody (M03), clone 2C7.
Lane 1: BIN1 transfected lysate(53 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BIN1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — BIN1
Entrez GeneID
274GeneBank Accession#
NM_004305Protein Accession#
NP_004296Gene Name
BIN1
Gene Alias
AMPH2, AMPHL, DKFZp547F068, MGC10367, SH3P9
Gene Description
bridging integrator 1
Gene Ontology
HyperlinkGene Summary
This gene encodes several isoforms of a nucleocytoplasmic adaptor protein, one of which was initially identified as a MYC-interacting protein with features of a tumor suppressor. Isoforms that are expressed in the central nervous system may be involved in synaptic vesicle endocytosis and may interact with dynanim, synaptojanin, endophilin, and clathrin. Isoforms that are expressed in muscle and ubiquitously expressed isoforms localize to the cytoplasm and nucleus and activate a caspase-independent apoptotic process. Studies in mouse suggest that this gene plays an important role in cardiac muscle development. Alternate splicing of the gene results in ten transcript variants encoding different isoforms. Aberrant splice variants expressed in tumor cell lines have also been described. [provided by RefSeq
Other Designations
OTTHUMP00000162179|OTTHUMP00000162183|amphiphysin II|amphiphysin-like|box dependant MYC interacting protein 1
-
Interactomes
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com