Product Browser

Last updated: 2014/9/29

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AMPD2 monoclonal antibody (M04A), clone 2G8

  • Catalog # : H00000271-M04A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant AMPD2.
  • Immunogen:
  • AMPD2 (NP_631895, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000271-M04A
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of AMPD2 expression in transfected 293T cell line by AMPD2 monoclonal antibody (M04A), clone 2G8.

    Lane 1: AMPD2 transfected lysate(92.1 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 271
  • Gene Name:
  • AMPD2
  • Gene Alias:
  • -
  • Gene Description:
  • adenosine monophosphate deaminase 2 (isoform L)
  • Gene Summary:
  • Adenosine monophosphate deaminase-2 (EC 3.5.4.6) catalyzes the deamination of AMP to IMP and plays an important role in the purine nucleotide cycle.[supplied by OMIM
  • Other Designations:
  • AMP deaminase 2,OTTHUMP00000013369,OTTHUMP00000013371
  • RSS
  • YouTube
  • Linkedin
  • Facebook