Product Browser
 
  • Related Product Showcase
  • By Research Area

  • By Hot Target
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

ALOX12B polyclonal antibody (A01)   

  • Catalog # : H00000242-A01
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 50 uL
  • USD $ 229
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ALOX12B.
  • Immunogen:
  • ALOX12B (NP_001130, 171 a.a. ~ 261 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • NPNRPEWNGYIPGFPILINFKATKFLNLNLRYSFLKTASFFVRLGPMALAFKVRGLLDCKHSWKRLKDIRKIFPGKKSVVSEYVAEHWAED
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000242-A01
    Western Blot detection against Immunogen (36.12 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ALOX12B polyclonal antibody (A01), Lot # 051130JC01 Western Blot analysis of ALOX12B expression in Jurkat ( Cat # L017V1 ).
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 242
  • Gene Name:
  • ALOX12B
  • Gene Alias:
  • 12R-LOX
  • Gene Description:
  • arachidonate 12-lipoxygenase, 12R type
  • Gene Summary:
  • This gene encodes an enzyme involved in the converstion of arachidonic acid to 12R-hydroxyeicosatetraenoic acid. Mutations in this gene are associated with nonbullous congenital ichthyosiform erythroderma. [provided by RefSeq
  • Other Designations:
  • epidermis-type lipoxygenase 12
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!