Product Browser

Last updated: 2014/4/21
  • Related Product Showcase
  • By Hot Target

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

ALDH1A1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00000216-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ALDH1A1 partial ORF ( AAH01505, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.51
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000216-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 216
  • Gene Name:
  • ALDH1A1
  • Gene Alias:
  • ALDC,ALDH-E1,ALDH1,ALDH11,MGC2318,PUMB1,RALDH1
  • Gene Description:
  • aldehyde dehydrogenase 1 family, member A1
  • Gene Summary:
  • This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme. This gene encodes a cytosolic isoform, which has a high affinity for aldehydes. [provided by RefSeq
  • Other Designations:
  • ALDH class 1,acetaldehyde dehydrogenase 1,aldehyde dehydrogenase 1, soluble,aldehyde dehydrogenase 1A1,aldehyde dehydrogenase, liver cytosolic,retinal dehydrogenase 1,retinaldehyde dehydrogenase 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook