Product Browser

Last updated: 2014/10/20
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ALDH1A1 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00000216-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human ALDH1A1 protein.
  • Immunogen:
  • ALDH1A1 (NP_000680.2, 1 a.a. ~ 501 a.a) full-length human protein.
  • Sequence:
  • MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • ALDH1A1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ALDH1A1 expression in human liver.
  • Protocol Download
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • ALDH1A1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ALDH1A1 expression in mouse lung.
  • Protocol Download
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • ALDH1A1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ALDH1A1 expression in mouse liver.
  • Protocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ALDH1A1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ALDH1A1 expression in HepG2.
  • Protocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ALDH1A1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ALDH1A1 expression in K-562.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ALDH1A1 expression in transfected 293T cell line (H00000216-T01) by ALDH1A1 MaxPab polyclonal antibody.

    Lane 1: ALDH1A1 transfected lysate(54.9 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of ALDH1A1 transfected lysate using anti-ALDH1A1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ALDH1A1 purified MaxPab mouse polyclonal antibody (B01P) (H00000216-B01P).
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 216
  • Gene Name:
  • ALDH1A1
  • Gene Alias:
  • ALDC,ALDH-E1,ALDH1,ALDH11,MGC2318,PUMB1,RALDH1
  • Gene Description:
  • aldehyde dehydrogenase 1 family, member A1
  • Gene Summary:
  • This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme. This gene encodes a cytosolic isoform, which has a high affinity for aldehydes. [provided by RefSeq
  • Other Designations:
  • ALDH class 1,acetaldehyde dehydrogenase 1,aldehyde dehydrogenase 1, soluble,aldehyde dehydrogenase 1A1,aldehyde dehydrogenase, liver cytosolic,retinal dehydrogenase 1,retinaldehyde dehydrogenase 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook