Product Browser

Last updated: 2014/7/7
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AHR monoclonal antibody (M02), clone 3B12

  • Catalog # : H00000196-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant AHR.
  • Immunogen:
  • AHR (NP_001612, 721 a.a. ~ 820 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000196-M02
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of AHR expression in transfected 293T cell line by AHR monoclonal antibody (M02), clone 3B12.

    Lane 1: AHR transfected lysate(96.147 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of AHR transfected lysate using anti-AHR monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with AHR MaxPab rabbit polyclonal antibody.
  • Protocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged AHR is approximately 0.03ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • Western blot analysis of AHR over-expressed 293 cell line, cotransfected with AHR Validated Chimera RNAi ( Cat # H00000196-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with AHR monoclonal antibody (M02), clone 3B12 (Cat # H00000196-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • Protocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 196
  • Gene Name:
  • AHR
  • Gene Alias:
  • bHLHe76
  • Gene Description:
  • aryl hydrocarbon receptor
  • Gene Summary:
  • This gene encodes a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Its ligands included a variety of aromatic hydrocarbons. [provided by RefSeq
  • Other Designations:
  • AH-receptor,aromatic hydrocarbon receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook