AHR monoclonal antibody (M02), clone 3B12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant AHR.
Immunogen
AHR (NP_001612, 721 a.a. ~ 820 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (65)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of AHR expression in transfected 293T cell line by AHR monoclonal antibody (M02), clone 3B12.
Lane 1: AHR transfected lysate(96.147 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of AHR transfected lysate using anti-AHR monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with AHR MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AHR is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of AHR over-expressed 293 cell line, cotransfected with AHR Validated Chimera RNAi ( Cat # H00000196-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with AHR monoclonal antibody (M02), clone 3B12 (Cat # H00000196-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to AHR on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — AHR
Entrez GeneID
196GeneBank Accession#
NM_001621Protein Accession#
NP_001612Gene Name
AHR
Gene Alias
bHLHe76
Gene Description
aryl hydrocarbon receptor
Omim ID
600253Gene Ontology
HyperlinkGene Summary
This gene encodes a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Its ligands included a variety of aromatic hydrocarbons. [provided by RefSeq
Other Designations
AH-receptor|aromatic hydrocarbon receptor
-
Interactome
-
Disease
-
Publication Reference
-
Protective effects of coffee against oxidative stress induced by the tobacco carcinogen benzo[α]pyrene.
Kalthoff S, Landerer S, Reich J, Strassburg CP.
Free Radical Biology & Medicine 2017 Mar; 108:66.
Application:WB-Ti, Mouse, Mouse colon, jejunum, liver.
-
Cross-talk between Aryl Hydrocarbon Receptor and the inflammatory response: a Role for NF-κB.
Vogel CF, Khan EM, Leung PS, Gershwin ME, Chang WL, Wu D, Haarmann-Stemmann T, Hoffmann A, Denison MS.
The Journal of Biological Chemistry 2014 Jan; 289(3):1866.
Application:WB-Ce, Human, Mouse, Dendritic, MEF cells.
-
Gender matters: estrogen receptor alpha (ERα) and histone deacetylase (HDAC) 1 and 2 control the gender-specific transcriptional regulation of human uridine diphosphate glucuronosyltransferases genes (UGT1A).
Kalthoff S, Winkler A, Freiberg N, Manns MP, Strassburg CP.
Journal of Hepatology 2013 Oct; 59(4):797.
Application:ChIP, Human, SW403, KYSE70 cells.
-
Malassezia-derived indoles activate the aryl hydrocarbon receptor and inhibit Toll-like receptor-induced maturation in monocyte-derived dendritic cells.
Vlachos C, Schulte BM, Magiatis P, Adema GJ, Gaitanis G.
The British Journal of Dermatology 2012 Sep; 167(3):496.
Application:IF, WB, Human, Human monocyte-derived dendritic cells.
-
Diminished carcinogen detoxification is a novel mechanism for hypoxia-inducible factor 1-mediated genetic instability.
Schults MA, Timmermans L, Godschalk RW, Theys J, Wouters BG, van Schooten FJ, Chiu RK.
The Journal of Biological Chemistry 2010 May; 285(19):14558.
Application:WB-Ce, Human, A-549 cells.
-
Protective effects of coffee against oxidative stress induced by the tobacco carcinogen benzo[α]pyrene.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com