AFP (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human AFP partial ORF ( AAH27881, 500 a.a. - 609 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
CCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Interspecies Antigen Sequence
Mouse (79); Rat (78)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — AFP
Entrez GeneID
174GeneBank Accession#
BC027881Protein Accession#
AAH27881Gene Name
AFP
Gene Alias
FETA, HPAFP
Gene Description
alpha-fetoprotein
Omim ID
104150Gene Ontology
HyperlinkGene Summary
This gene encodes alpha-fetoprotein, a major plasma protein produced by the yolk sac and the liver during fetal life. Alpha-fetoprotein expression in adults is often associated with hepatoma or teratoma. However, hereditary persistance of alpha-fetoprotein may also be found in individuals with no obvious pathology. The protein is thought to be the fetal counterpart of serum albumin, and the alpha-fetoprotein and albumin genes are present in tandem in the same transcriptional orientation on chromosome 4. Alpha-fetoprotein is found in monomeric as well as dimeric and trimeric forms, and binds copper, nickel, fatty acids and bilirubin. The level of alpha-fetoprotein in amniotic fluid is used to measure renal loss of protein to screen for spina bifida and anencephaly. [provided by RefSeq
Other Designations
OTTHUMP00000160480|alpha-1-fetoprotein|alpha-fetoglobulin
-
Interactome
-
Disease
-
Publication Reference
-
Magnetofluorescent nanocomposites and quantum dots used for optimal application in magnetic fluorescence-linked immunoassay.
Tsai HY, Li SY, Fuh CB.
Analytical and Bioanalytical Chemistry 2018 Mar; 410(7):1923.
Application:ELISA, Serum samples.
-
Multifunctional Nanoparticles for Protein Detections in Thin Channels.
Hweiyan Tsai, Weimin Lin, Mingchieh Chuang, Yishuan Lu, C Bor Fuh.
Biosensors & Bioelectronics 2017 Apr; 90:153.
Application:ELISA, Human, Human serum, Recombinant protein.
-
Magnetofluorescent nanocomposites and quantum dots used for optimal application in magnetic fluorescence-linked immunoassay.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com