PARP1 monoclonal antibody (M01), clone 3G4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PARP1.
Immunogen
PARP1 (AAH37545, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (94)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PARP1 monoclonal antibody (M01), clone 3G4 Western Blot analysis of PARP1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PARP1 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PARP1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — PARP1
Entrez GeneID
142GeneBank Accession#
BC037545Protein Accession#
AAH37545Gene Name
PARP1
Gene Alias
ADPRT, ADPRT1, PARP, PARP-1, PPOL, pADPRT-1
Gene Description
poly (ADP-ribose) polymerase 1
Omim ID
173870Gene Ontology
HyperlinkGene Summary
This gene encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation. The modification is dependent on DNA and is involved in the regulation of various important cellular processes such as differentiation, proliferation, and tumor transformation and also in the regulation of the molecular events involved in the recovery of cell from DNA damage. In addition, this enzyme may be the site of mutation in Fanconi anemia, and may participate in the pathophysiology of type I diabetes. [provided by RefSeq
Other Designations
ADP-ribosyltransferase (NAD+; poly (ADP-ribose) polymerase)|ADP-ribosyltransferase NAD(+)|OTTHUMP00000035663|poly (ADP-ribose) polymerase family, member 1|poly(ADP-ribose) polymerase|poly(ADP-ribose) synthetase|poly(ADP-ribosyl)transferase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The poly(ADP-ribose) polymerase inhibitor olaparib induces up-regulation of death receptors in primary acute myeloid leukemia blasts by NF-κB activation.
Faraoni I, Aloisio F, De Gabrieli A, Consalvo MI, Lavorgna S, Voso MT, Lo-Coco F, Graziani G.
Cancer Letters 2018 Jun; 423:127.
Application:WB, Human, Acute myeloid leukemia primary blasts.
-
BRCA1, PARP1 and γH2AX in Acute Myeloid Leukemia: Role as Biomarkers of Response to the PARP Inhibitor Olaparib.
Faraoni I, Compagnone M, Lavorgna S, Angelini DF, Cencioni MT, Piras E, Panetta P, Ottone T, Dolci S, Venditti A, Graziani G, Lo-Coco F.
Biochimica et Biophysica Acta 2015 Mar; 1852(3):462.
Application:WB-Ce, Human, Hela, U937, OCI-AML2, OCI-AML3, HL-60, HL-60R, NB4, AML cells.
-
The ADP-ribosyltransferase PARP10/ARTD10 interacts with Proliferating Cell Nuclear Antigen (PCNA) and is required for DNA damage tolerance.
Nicolae CM, Aho ER, Vlahos AH, Choe KN, De S, Karras GI, Moldovan GL.
The Journal of Biological Chemistry 2014 May; 289(19):13627.
Application:IP, Human, 293T cells.
-
Regulation of FANCD2 by the mTOR pathway contributes to the resistance of cancer cells to DNA double strand breaks.
Shen C, Oswald D, Phelps D, Cam H, Pelloski CE, Pang Q, Houghton PJ.
Cancer Research 2013 Jun; 73(11):3393.
Application:WB-Ce, Human, Rh30 cells.
-
PARP1 promotes nucleotide excision repair through DDB2 stabilization and recruitment of ALC1.
Pines A, Vrouwe MG, Marteijn JA, Typas D, Luijsterburg MS, Cansoy M, Hensbergen P, Deelder A, de Groot A, Matsumoto S, Sugasawa K, Thoma N, Vermeulen W, Vrieling H, Mullenders L.
Journal of Cell Biology 2012 Oct; 199(2):235.
Application:IP, WB-Ce, WB-Tr, Human, NHF, U-2 OS cells.
-
DDB2 promotes chromatin decondensation at UV-induced DNA damage.
Luijsterburg MS, Lindh M, Acs K, Vrouwe MG, Pines A, van Attikum H, Mullenders LH, Dantuma NP.
The Journal of Cell Biology 2012 Apr; 197(2):267.
Application:WB-Tr, Human, U2OS cells.
-
The Metastasis Efficiency Modifier Ribosomal RNA Processing 1 Homolog B (RRP1B) Is a Chromatin-associated Factor.
Crawford NP, Yang H, Mattaini KR, Hunter KW.
The Journal of Biological Chemistry 2009 Oct; 284(42):28660.
Application:WB-Tr, Human, HEK 293 cells.
-
The poly(ADP-ribose) polymerase inhibitor olaparib induces up-regulation of death receptors in primary acute myeloid leukemia blasts by NF-κB activation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com