Product Browser

Last updated: 2014/9/1
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ADORA2A purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00000135-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human ADORA2A protein.
  • Immunogen:
  • ADORA2A (AAH13780.1, 1 a.a. ~ 412 a.a) full-length human protein.
  • Sequence:
  • MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Flow Cytometry
  • Flow Cytometry enlargeenlarge this image
  • FACS analysis of negative control 293 cells (Black) and ADORA2A expressing 293 cells (Green) using ADORA2A purified MaxPab mouse polyclonal antibody.
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ADORA2A MaxPab polyclonal antibody. Western Blot analysis of ADORA2A expression in HeLa.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ADORA2A expression in transfected 293T cell line (H00000135-T02) by ADORA2A MaxPab polyclonal antibody.

    Lane 1: ADORA2A transfected lysate(45.43 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 135
  • Gene Name:
  • ADORA2A
  • Gene Alias:
  • ADORA2,RDC8,hA2aR
  • Gene Description:
  • adenosine A2a receptor
  • Gene Summary:
  • This gene encodes a protein which is one of several receptor subtypes for adenosine. The activity of the encoded protein, a G-protein coupled receptor family member, is mediated by G proteins which activate adenylyl cyclase. The encoded protein is abundant in basal ganglia, vasculature and platelets and it is a major target of caffeine. [provided by RefSeq
  • Other Designations:
  • adenosine A2 receptor,adenosine receptor subtype A2a
  • RSS
  • YouTube
  • Linkedin
  • Facebook