- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25865)
- MaxPab® Ab (16217)
- Monoclonal Ab (21396)
- Polyclonal Ab (27483)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9167)
- Ab Pairs/Kits (7698)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2015)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2113)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (17916)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
- Related Product Showcase
- By Research Area
- By Pathway
- By Hot Target
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > Polyclonal Ab > Human > Metabolism > ADCY7 polyclonal antibody (A01)
ADCY7 polyclonal antibody (A01)
- Catalog # : H00000113-A01
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 50 uL
- USD $ 229
- order now, ship next day
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Mouse polyclonal antibody raised against a partial recombinant ADCY7.
- Immunogen:
- ADCY7 (NP_001105, 197 a.a. ~ 277 a.a) partial recombinant protein with GST tag.
- Sequence:
- HKHQMQDASRDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLPAHISMGMKLAIIERLKEHGDRRCMPDNNFHSLYVKRHQN
- Host:
- Mouse
- Reactivity:
- Human
- Quality Control Testing:
- Antibody Reactive Against Recombinant Protein.
- Storage Buffer:
- 50 % glycerol
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- MSDS:
Download
- Publication Reference
- 1.
- Distinct metabolism of cyclic adenosine monophosphate in regulatory and helper CD4(+) T cells.
Bazhin AV, Kahnert S, Kimpfler S, Schadendorf D, Umansky V.Mol Immunol. 2009 Nov 23. [Epub ahead of print]
- Application Image
- ELISA
- Entrez GeneID:
- 113
- GeneBank Accession#:
- NM_001114
- Protein Accession#:
- NP_001105
- Gene Name:
- ADCY7
- Gene Alias:
- AC7,FLJ36387,KIAA0037
- Gene Description:
- adenylate cyclase 7
- Omim ID:
- 600385
- Gene Ontology:
- Hyperlink
- Gene Summary:
- This gene encodes a membrane-bound adenylate cyclase that catalyses the formation of cyclic AMP from ATP and is inhibitable by calcium. The product of this gene is a member of the adenylyl cyclase class-4/guanylyl cyclase enzyme family that is characterized by the presence of twelve membrane-spanning domains in its sequences. [provided by RefSeq
- Other Designations:
- ATP pyrophosphate-lyase,OTTHUMP00000164225,adenylyl cyclase
- Related Disease
