Product Browser

Last updated: 2014/10/20
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ADCY7 polyclonal antibody (A01)

  • Catalog # : H00000113-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ADCY7.
  • Immunogen:
  • ADCY7 (NP_001105, 197 a.a. ~ 277 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • HKHQMQDASRDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLPAHISMGMKLAIIERLKEHGDRRCMPDNNFHSLYVKRHQN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 113
  • Gene Name:
  • ADCY7
  • Gene Alias:
  • AC7,FLJ36387,KIAA0037
  • Gene Description:
  • adenylate cyclase 7
  • Gene Summary:
  • This gene encodes a membrane-bound adenylate cyclase that catalyses the formation of cyclic AMP from ATP and is inhibitable by calcium. The product of this gene is a member of the adenylyl cyclase class-4/guanylyl cyclase enzyme family that is characterized by the presence of twelve membrane-spanning domains in its sequences. [provided by RefSeq
  • Other Designations:
  • ATP pyrophosphate-lyase,OTTHUMP00000164225,adenylyl cyclase
  • RSS
  • YouTube
  • Linkedin
  • Facebook