ADCY2 monoclonal antibody (M01), clone 1D4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ADCY2 is approximately 1ng/ml as a capture antibody.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between GNAS and ADCY2. HeLa cells were stained with anti-GNAS rabbit purified polyclonal 1:1200 and anti-ADCY2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ADCY2.
Immunogen
ADCY2 (NP_065433, 977 a.a. ~ 1086 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLSQSNVAS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ADCY2 is approximately 1ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between GNAS and ADCY2. HeLa cells were stained with anti-GNAS rabbit purified polyclonal 1:1200 and anti-ADCY2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — ADCY2
Entrez GeneID
108GeneBank Accession#
NM_020546Protein Accession#
NP_065433Gene Name
ADCY2
Gene Alias
AC2, FLJ16822, FLJ45092, HBAC2, KIAA1060, MGC133314
Gene Description
adenylate cyclase 2 (brain)
Omim ID
103071Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the family of adenylate cyclases, which are membrane-associated enzymes that catalyze the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). This enzyme is insensitive to Ca(2+)/calmodulin, and is stimulated by the G protein beta and gamma subunit complex. [provided by RefSeq
Other Designations
3',5'-cyclic AMP synthetase|ATP pyrophosphate-lyase|adenylate cyclase 2|adenylate cyclase II|adenylyl cyclase 2|type II adenylate cyclase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com