Product Browser
 
  • Related Product Showcase
  • By Hot Target
  • By Application
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

ACY1 monoclonal antibody (M01), clone 4F1-B7   

  • Catalog # : H00000095-M01
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 100 ug
  • USD $ 319
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant ACY1.
  • Immunogen:
  • ACY1 (AAH00545, 1 a.a. ~ 408 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MTSKGPAEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDVKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000095-M01
    Western Blot detection against Immunogen (70.62 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.2
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • ACY1 monoclonal antibody (M01), clone 4F1-B7. Western Blot analysis of ACY1 expression in K-562 ( Cat # L009V1 ).
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ACY1 expression in transfected 293T cell line by ACY1 monoclonal antibody (M01), clone 4F1-B7.

    Lane 1: ACY1 transfected lysate(45.9 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)enlargeenlarge this image
  • Immunoperoxidase of monoclonal antibody to ACY1 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. [antibody concentration 3 ug/ml]
  • Protocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of ACY1 transfected lysate using anti-ACY1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ACY1 MaxPab rabbit polyclonal antibody.
  • Protocol Download
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged ACY1 is approximately 0.1ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Sandwich ELISA (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 95
  • Gene Name:
  • ACY1
  • Gene Alias:
  • ACY1D,ACYLASE
  • Gene Description:
  • aminoacylase 1
  • Gene Summary:
  • Aminoacylase-1 is a cytosolic, homodimeric, zinc-binding enzyme that catalyzes the hydrolysis of acylated L-amino acids to L-amino acids and acyl group, and has been postulated to function in the catabolism and salvage of acylated amino acids. ACY1 has been assigned to chromosome 3p21.1, a region reduced to homozygosity in small-cell lung cancer (SCLC), and its expression has been reported to be reduced or undetectable in SCLC cell lines and tumors. The amino acid sequence of human aminoacylase-1 is highly homologous to the porcine counterpart, and ACY1 is the first member of a new family of zinc-binding enzymes. [provided by RefSeq
  • Other Designations:
  • -
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!