ACY1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (70.99 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length recombinant ACY1.
Immunogen
ACY1 (AAH00545, 1 a.a. ~ 408 a.a) full-length recombinant protein with GST tag.
Sequence
MTSKGPAEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDVKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (87)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (70.99 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — ACY1
Entrez GeneID
95GeneBank Accession#
BC000545Protein Accession#
AAH00545Gene Name
ACY1
Gene Alias
ACY1D, ACYLASE
Gene Description
aminoacylase 1
Gene Ontology
HyperlinkGene Summary
Aminoacylase-1 is a cytosolic, homodimeric, zinc-binding enzyme that catalyzes the hydrolysis of acylated L-amino acids to L-amino acids and acyl group, and has been postulated to function in the catabolism and salvage of acylated amino acids. ACY1 has been assigned to chromosome 3p21.1, a region reduced to homozygosity in small-cell lung cancer (SCLC), and its expression has been reported to be reduced or undetectable in SCLC cell lines and tumors. The amino acid sequence of human aminoacylase-1 is highly homologous to the porcine counterpart, and ACY1 is the first member of a new family of zinc-binding enzymes. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Publication Reference
-
Acylase 1 expression in rat intestinal crypt-villus axis.
Cigna N, Nicoletti C, Durand A, Chaix JC, Giardina T, Perrier J.
Cell Biology International 2007 Mar; 31(9):966.
Application：IF, WB-Ti, Rat, Rat intestinal crypt- villus axis, digestive tract.
-
Aminoacylase I deficiency: a novel inborn error of metabolism.
Van Coster RN, Gerlo EA, Giardina TG, Engelke UF, Smet JE, De Praeter CM, Meersschaut VA, De Meirleir LJ, Seneca SH, Devreese B, Leroy JG, Herga S, Perrier JP, Wevers RA, Lissens W.
Biochemical and Biophysical Research Communications 2005 Nov; 338(3):1322.
Application：WB, Human, Lymphoblasts from the patient.
-
Acylase 1 expression in rat intestinal crypt-villus axis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com