Product Browser
 
  • Related Product Showcase
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

ACTN1 monoclonal antibody (M01), clone 3F1   

  • Catalog # : H00000087-M01
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 100 ug
  • USD $ 319
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant ACTN1.
  • Immunogen:
  • ACTN1 (NP_001093, 543 a.a. ~ 639 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • EIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG3 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000087-M01
    Western Blot detection against Immunogen (36.41 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.2
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ACTN1 expression in transfected 293T cell line by ACTN1 monoclonal antibody (M01), clone 3F1.

    Lane 1: ACTN1 transfected lysate(103.1 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged ACTN1 is approximately 10ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 87
  • Gene Name:
  • ACTN1
  • Gene Alias:
  • FLJ40884
  • Gene Description:
  • actinin, alpha 1
  • Gene Summary:
  • Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, cytoskeletal, alpha actinin isoform and maps to the same site as the structurally similar erythroid beta spectrin gene. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • F-actin cross-linking protein,actinin 1 smooth muscle,alpha-actinin 1
  • Interactome
  • Related Disease
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!