ACP5 monoclonal antibody (M01), clone 2D9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ACP5 is 1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to ACP5 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.31 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ACP5.
Immunogen
ACP5 (AAH25414.1, 72 a.a. ~ 158 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTV
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.31 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ACP5 is 1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to ACP5 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — ACP5
Entrez GeneID
54GeneBank Accession#
BC025414Protein Accession#
AAH25414.1Gene Name
ACP5
Gene Alias
MGC117378, TRAP
Gene Description
acid phosphatase 5, tartrate resistant
Omim ID
171640Gene Ontology
HyperlinkGene Summary
This gene encodes an iron containing glycoprotein which catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is the most basic of the acid phosphatases and is the only form not inhibited by L(+)-tartrate. [provided by RefSeq
Other Designations
TrATPase|tartrate resistant acid phosphatase 5|tartrate-resistant acid ATPase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Tartrate-resistant acid phosphatase 5 promotes pulmonary fibrosis by modulating β-catenin signaling.
Yinan Hu, Qi Wang, Jun Yu, Qing Zhou, Yanhan Deng, Juan Liu, Lei Zhang, Yongjian Xu, Weining Xiong, Yi Wang.
Nature Communications 2022 Jan; 13(1):114.
Application：IF, Mouse, Primary mice lung fibroblasts.
-
Tartrate-Resistant Acid Phosphatase 5/ACP5 Interacts with p53 to Control the Expression of SMAD3 in Lung Adenocarcinoma.
Yinan Hu, Jun Yu, Qi Wang, Lei Zhang, Xueying Chen, Yong Cao, Jianping Zhao, Yongjian Xu, Dingsheng Jiang, Yi Wang, Weining Xiong.
Molecular Therapy Oncolytics 2020 Mar; 16:272.
Application：Co-IP, Human, A549.
-
Tartrate-resistant acid phosphatase 5 promotes pulmonary fibrosis by modulating β-catenin signaling.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com