Product Browser

Last updated: 2014/7/21
  • Related Product Showcase
  • By Hot Target

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ABO (Human) Recombinant Protein (Q01)

  • Catalog # : H00000028-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ABO partial ORF ( NP_065202.2, 273 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.76
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00000028-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 28
  • Gene Name:
  • ABO
  • Gene Alias:
  • A3GALNT,A3GALT1,GTB,NAGAT
  • Gene Description:
  • ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase)
  • Gene Summary:
  • This gene encodes proteins related to the first discovered blood group system, ABO. Which allele is present in an individual determines the blood group. The 'O' blood group is caused by a deletion of guanine-258 near the N-terminus of the protein which results in a frameshift and translation of an almost entirely different protein. Individuals with the A, B, and AB alleles express glycosyltransferase activities that convert the H antigen into the A or B antigen. Other minor alleles have been found for this gene. [provided by RefSeq
  • Other Designations:
  • ABO glycocyltransferase,ABO glycosyltransferase,B(A) alpha-1,3-galactosyltransferase,alpha 1-3-N-acetylgalactosaminyltransferase,histo-blood group A2 transferase,histo-blood group ABO protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook