ABL2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ABL2 partial ORF ( AAH65912, 743 a.a. - 842 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.41
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ABL2
Entrez GeneID
27GeneBank Accession#
BC065912Protein Accession#
AAH65912Gene Name
ABL2
Gene Alias
ABLL, ARG, FLJ22224, FLJ31718, FLJ41441
Gene Description
v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene)
Omim ID
164690Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the Abelson family of nonreceptor tyrosine protein kinase. The protein is highly similar to the ABL1 protein, including the tyrosine kinase, SH2 and SH3 domains, and has a role in cytoskeletal rearrangements by its C-terminal F-actin- and microtubule-binding sequences. This gene is expressed in both normal and tumor cells, and is involved in translocation with the ETV6 gene in leukemia. Multiple alternatively spliced transcript variants encoding different protein isoforms have been found for this gene. [provided by RefSeq
Other Designations
Abelson murine leukemia viral (v-abl) oncogene homolog 2|Abelson-related gene protein|OTTHUMP00000033139|arg tyrosine kinase|v-abl Abelson murine leukemia viral oncogene homolog 2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com