Product Browser

Last updated: 2014/9/9
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NAT1 polyclonal antibody (A01)

  • Catalog # : H00000009-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant NAT1.
  • Immunogen:
  • NAT1 (NP_000653, 201 a.a. ~ 290 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00000009-A01
    Western Blot detection against Immunogen (36.01 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9
  • Gene Name:
  • NAT1
  • Gene Alias:
  • AAC1,NATI
  • Gene Description:
  • N-acetyltransferase 1 (arylamine N-acetyltransferase)
  • Gene Summary:
  • This gene is one of two arylamine N-acetyltransferase (NAT) genes in the human geneome, and is orthologous to the mouse and rat Nat2 genes. The enzyme encoded by this gene catalyzes the transfer of an acetyl group from acetyl-CoA to various arylamine and hydrazine substrates. This enzyme helps metabolize drugs and other xenobiotics, and functions in folate catabolism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • N-acetyltransferase 1,OTTHUMP00000122488,arylamide acetylase 1 (N-acetyltransferase 1),arylamine N-acetyltransferase 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook