Product Browser

Last updated: 2014/7/14

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

APOM (Human) Recombinant Protein (P01)

  • Catalog # : H00055937-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human APOM full-length ORF ( AAH20683, 23 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • CPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00055937-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • APOM
  • Gene Alias:
  • G3a,HSPC336,MGC22400,NG20
  • Gene Description:
  • apolipoprotein M
  • Gene Summary:
  • The protein encoded by this gene is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. The encoded protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport. Two transcript variants encoding two different isoforms have been found for this gene, but only one of them has been fully characterized. [provided by RefSeq
  • Other Designations:
  • NG20-like protein,OTTHUMP00000029364,alternative name: G3a, NG20
  • RSS
  • YouTube
  • Linkedin
  • Facebook