NDUFB6 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human NDUFB6 full-length ORF ( AAH29247, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
39.82
Interspecies Antigen Sequence
Mouse (70); Rat (70)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — NDUFB6
Entrez GeneID
4712GeneBank Accession#
BC029247Protein Accession#
AAH29247Gene Name
NDUFB6
Gene Alias
B17, CI, MGC13675
Gene Description
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa
Omim ID
603322Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq
Other Designations
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6 (17kD, B17)|NADH-ubiquinone oxidoreductase B17 subunit|NADH-ubiquinone oxidoreductase beta subunit, 6|OTTHUMP00000021179|OTTHUMP00000021180|complex I, mitochondrial respiratory chain, B17 subunit
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com