ANXA4 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ANXA4 full-length ORF ( AAH00182, 1 a.a. - 321 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAMATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
61.05
Interspecies Antigen Sequence
Mouse (92); Rat (93)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ANXA4
Entrez GeneID
307GeneBank Accession#
BC000182Protein Accession#
AAH00182Gene Name
ANXA4
Gene Alias
ANX4, DKFZp686H02120, MGC75105, PIG28, ZAP36
Gene Description
annexin A4
Omim ID
106491Gene Ontology
HyperlinkGene Summary
Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. [provided by RefSeq
Other Designations
annexin IV|annexin IV (placental anticoagulant protein II)|placental anticoagulant protein II|proliferation-inducing gene 28|proliferation-inducing protein 28
-
Interactome
-
Disease
-
Publication Reference
-
Prostate cancer biomarker annexin A3 detected in urines obtained following digital rectal examination presents antigenic variability.
Hamelin-Peyron C, Vlaeminck-Guillem V, Haïdous H, Schwall GP, Poznanović S, Gorius-Gallet E, Michel S, Larue A, Guillotte M, Ruffion A, Choquet-Kastylevsky G, Ataman-Önal Y.
Clinical Biochemistry 2014 Jul; 47(10-11):901.
Application:ELISA, Func, WB-Re, Human, Human urine.
-
Prostate cancer biomarker annexin A3 detected in urines obtained following digital rectal examination presents antigenic variability.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com