UBE2D2 monoclonal antibody (M02), clone 4A1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant UBE2D2.
Immunogen
UBE2D2 (NP_003330, 1 a.a. ~ 94 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWS
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.08 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
UBE2D2 monoclonal antibody (M02), clone 4A1. Western Blot analysis of UBE2D2 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
UBE2D2 monoclonal antibody (M02), clone 4A1 Western Blot analysis of UBE2D2 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
UBE2D2 monoclonal antibody (M02), clone 4A1. Western Blot analysis of UBE2D2 expression in PC-12 ( Cat # L012V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to UBE2D2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UBE2D2 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — UBE2D2
Entrez GeneID
7322GeneBank Accession#
NM_003339Protein Accession#
NP_003330Gene Name
UBE2D2
Gene Alias
E2(17)KB2, PUBC1, UBC4, UBC4/5, UBCH5B
Gene Description
ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast)
Omim ID
602962Gene Ontology
HyperlinkGene Summary
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Two alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms. [provided by RefSeq
Other Designations
ubiquitin carrier protein|ubiquitin-conjugating enzyme E2 D2|ubiquitin-conjugating enzyme E2-17 kDa 2|ubiquitin-conjugating enzyme E2D 2|ubiquitin-conjugating enzyme E2D 2 (homologous to yeast UBC4/5)
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Clinical and functional characterization of a novel STUB1 frameshift mutation in autosomal dominant spinocerebellar ataxia type 48 (SCA48).
Huan-Yun Chen, Chia-Lang Hsu, Han-Yi Lin, Yung-Feng Lin, Shih-Feng Tsai, Yu-Jung Ho, Ye-Ru Li, Jin-Wu Tsai, Shu-Chun Teng, Chin-Hsien Lin.
Journal of Biomedical Science 2021 Sep; 28(1):65.
Application:WB-Tr, Human, SH-SY5Y cells.
-
A 4-gene signature predicts survival of patients with resected adenocarcinoma of the esophagus, junction, and gastric cardia.
Peters CJ, Rees JR, Hardwick RH, Hardwick JS, Vowler SL, Ong CA, Zhang C, Save V, O'Donovan M, Rassl D, Alderson D, Caldas C, Fitzgerald RC, OCCAMS Study Group.
Gastroenterology 2010 Dec; 139(6):1995.
Application:IHC, Human, Esophageal and junctional adenocarcinoma.
-
Clinical and functional characterization of a novel STUB1 frameshift mutation in autosomal dominant spinocerebellar ataxia type 48 (SCA48).
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com