Home > Products > Monoclonal Ab > Human > Plasma/Serum > ACE monoclonal antibody (M01), clone 6A4

ACE monoclonal antibody (M01), clone 6A4

Immunogen:
ACE (AAH36375, 592 a.a. ~ 701 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence:
RLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNSDDFYNETETKIFLQFYDQTGIWDHGAPHLLPPSQARGTREAPVYM

Quality Control Testing:
Antibody Reactive Against Recombinant Protein.

Western Blot detection against Immunogen (37.73 KDa) .

1.
Phosphorylation of the Eukaryotic Translation Initiation Factor 4E-Transporter (4E-T) by c-Jun N-Terminal Kinase Promotes Stress-Dependent P-Body Assembly.
Cargnello M, Tcherkezian J, Dorn JF, Huttlin EL, Maddox PS, Gygi SP, Roux PP.Mol Cell Biol. 2012 Nov;32(22):4572-84. doi: 10.1128/MCB.00544-12. Epub 2012 Sep 10.

3.
Drosophila genome-wide RNAi screen identifies multiple regulators of HIF-dependent transcription in hypoxia.
Dekanty A, Romero NM, Bertolin AP, Thomas MG, Leishman CC, Perez-Perri JI, Boccaccio GL, Wappner P.PLoS Genet. 2010 Jun 24;6(6):e1000994.

Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ACE is approximately 0.03ng/ml as a capture antibody.
Protocol Download

Gene Summary:
This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies. Two most abundant alternatively spliced variants of this gene encode two isozymes - the somatic form and the testicular form that are equally active. Multiple additional alternatively spliced variants have been identified but their full length nature has not been determined. [provided by RefSeq

Other Designations:
CD143 antigen,angiotensin I converting enzyme,angiotensin converting enzyme, somatic isoform,carboxycathepsin,dipeptidyl carboxypeptidase 1,kininase II,peptidase P,peptidyl-dipeptidase A,testicular ECA