PCP4 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human PCP4.
Immunogen
Recombinant protein corresponding to human PCP4.
Sequence
GAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKK
Host
Rabbit
Reactivity
Human, Mouse
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Tissue lysate)
Western Blot analysis of human cerebral cortex tissue lysate with PCP4 polyclonal antibody (Cat # PAB31506).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebellum with PCP4 polyclonal antibody (Cat # PAB31506) shows strong cytoplasmic positivity in Purkinje cells. -
Gene Info — PCP4
-
Interactome
-
Disease
-
Publication Reference
-
Complementary Modular Microcircuits of the Rat Medial Entorhinal Cortex.
Ray S, Burgalossi A, Brecht M, Naumann RK.
Frontiers in Systems Neuroscience 2017 Apr; 11:20.
Application:IF, IHC-Fr, Rat, Rat brain, Rat medial entorhinal cortex.
-
Altered Oscillatory Dynamics of CA1 Parvalbumin Basket Cells during Theta-Gamma Rhythmopathies of Temporal Lobe Epilepsy.
Lopez-Pigozzi D, Laurent F, Brotons-Mas JR, Valderrama M, Valero M, Fernandez-Lamo I, Cid E, Gomez-Dominguez D, Gal B, Menendez de la Prida L.
eNeuro 2016 Nov; 3(6):ENEURO.028.
Application:IF, Rat, Brain.
-
Structural development and dorsoventral maturation of the medial entorhinal cortex.
Ray S, Brecht M.
eLife 2016 Apr; 5:e13343.
Application:IF, IHC-Fr, Rat, Rat brain.
-
Determinants of different deep and superficial CA1 pyramidal cell dynamics during sharp-wave ripples.
Valero M, Cid E, Averkin RG, Aguilar J, Sanchez-Aguilera A, Viney TJ, Gomez-Dominguez D, Bellistri E, de la Prida LM.
Nature Neuroscience 2015 Sep; 18(9):1281.
Application:IF, IHC, Rat, Rat brain.
-
DACH1, a zona glomerulosa selective gene in the human adrenal, activates transforming growth factor-β signaling and suppresses aldosterone secretion.
Zhou J, Shaikh LH, Neogi SG, McFarlane I, Zhao W, Figg N, Brighton CA, Maniero C, Teo AE, Azizan EA, Brown MJ.
Hypertension 2015 May; 65(5):1103.
Application:IHC-P, Human, Human adrenal sections.
-
Distribution of interneurons in the CA2 region of the rat hippocampus.
Botcher NA, Falck JE, Thomson AM, Mercer A.
Frontiers in Neuroanatomy 2014 Sep; 8:104.
Application:IF, IHC-Fr, Rat, Rat brain, Rat hippocampus.
-
The hippocampal CA2 region is essential for social memory.
Hitti FL, Siegelbaum SA.
Nature 2014 Apr; 508(7494):88.
Application:IF, IHC, Mouse, Mouse brains.
-
Cell type-specific genetic and optogenetic tools reveal hippocampal CA2 circuits.
Kohara K, Pignatelli M, Rivest AJ, Jung HY, Kitamura T, Suh J, Frank D, Kajikawa K, Mise N, Obata Y, Wickersham IR, Tonegawa S.
Nature Neuroscience 2014 Feb; 17(2):269.
Application:IF, IHC, Mouse, Mouse hippocampus.
-
Complementary Modular Microcircuits of the Rat Medial Entorhinal Cortex.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com