BNIP3L polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human epididymis with BNIP3L polyclonal antibody (Cat # PAB31456) shows strong cytoplasmic positivity.
Immunofluorescence
Immunofluorescent staining of U-2 OS cells with BNIP3L polyclonal antibody (Cat # PAB31456) (Green) shows localization to nuclear speckles and mitochondria.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human BNIP3L.
Immunogen
Recombinant protein corresponding to human BNIP3L.
Sequence
SNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMK
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human epididymis with BNIP3L polyclonal antibody (Cat # PAB31456) shows strong cytoplasmic positivity.Immunofluorescence
Immunofluorescent staining of U-2 OS cells with BNIP3L polyclonal antibody (Cat # PAB31456) (Green) shows localization to nuclear speckles and mitochondria. -
Gene Info — BNIP3L
Entrez GeneID
665Protein Accession#
O60238Gene Name
BNIP3L
Gene Alias
BNIP3a, NIX
Gene Description
BCL2/adenovirus E1B 19kDa interacting protein 3-like
Omim ID
605368Gene Ontology
HyperlinkGene Summary
This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19 kDa-like sequences of BCL2, also an apoptotic protector. The protein encoded by this gene is a functional homolog of BNIP3, a proapoptotic protein. This protein may function simultaneously with BNIP3 and may play a role in tumor suppression. [provided by RefSeq
Other Designations
BCL2/adenovirus E1B 19-kd protein-interacting protein 3a|BCL2/adenovirus E1B 19kD-interacting protein 3-like|adenovirus E1B19k-binding protein B5
-
Interactome
-
Disease
-
Publication Reference
-
MicroRNA-137 is a novel hypoxia-responsive microRNA that inhibits mitophagy via regulation of two mitophagy receptors FUNDC1 and NIX.
Li W, Zhang X, Zhuang H, Chen HG, Chen Y, Tian W, Wu W, Li Y, Wang S, Zhang L, Chen Y, Li L, Zhao B, Sui S, Hu Z, Feng D.
The Journal of Biological Chemistry 2014 Apr; 289(15):10691.
Application：WB-Tr, Human, HEK 293, HeLa, SKNSH, SY5Y cells.
-
Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells.
Charlotte Stadler, Elton Rexhepaj, Vasanth R Singan, Robert F Murphy, Rainer Pepperkok, Mathias Uhlén, Jeremy C Simpson, Emma Lundberg.
Nature Methods 2013 Apr; 10(4):315.
-
MicroRNA-137 is a novel hypoxia-responsive microRNA that inhibits mitophagy via regulation of two mitophagy receptors FUNDC1 and NIX.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com