CDK7 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with CDK7 polyclonal antibody (Cat # PAB30788).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with CDK7 polyclonal antibody (Cat # PAB30788) shows strong nuclear and moderate cytoplasmic positivity in neuronal cells. Glial cells showed weaker staining.
Immunofluorescence
Immunofluorescent staining of U-2 OS with CDK7 polyclonal antibody (Cat # PAB30788) (Green) shows positivity in nucleus and mitochondria.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human CDK7.
Immunogen
Recombinant protein corresponding to human CDK7.
Sequence
GCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLI
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of Lane 1: negative control (vector only transfected HEK293T cell lysate) and Lane 2: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells) with CDK7 polyclonal antibody (Cat # PAB30788).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with CDK7 polyclonal antibody (Cat # PAB30788) shows strong nuclear and moderate cytoplasmic positivity in neuronal cells. Glial cells showed weaker staining.Immunofluorescence
Immunofluorescent staining of U-2 OS with CDK7 polyclonal antibody (Cat # PAB30788) (Green) shows positivity in nucleus and mitochondria. -
Gene Info — CDK7
Entrez GeneID
1022Protein Accession#
P50613Gene Name
CDK7
Gene Alias
CAK1, CDKN7, MO15, STK1, p39MO15
Gene Description
cyclin-dependent kinase 7
Omim ID
601955Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle. [provided by RefSeq
Other Designations
39 KDa protein kinase|Cdk-activating kinase|cell division protein kinase 7|cyclin-dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk-activating kinase)|homolog of Xenopus MO15 Cdk-activating kinase|kinase subunit of CAK|serine/threonine kinase stk1|ser
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com