NUP62 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: RT-4 and Lane 2: U-251MG sp cell lysates with NUP62 polyclonal antibody (Cat # PAB30728).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with NUP62 polyclonal antibody (Cat # PAB30728) shows strong nuclear membrane and cytoplasmic positivity in neuronal cells.
Immunofluorescence
Immunofluorescent staining of U-251 MG with NUP62 polyclonal antibody (Cat # PAB30728) (Green) shows positivity in nuclear membrane.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human NUP62.
Immunogen
Recombinant protein corresponding to human NUP62.
Sequence
GGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPATSTPSTGLFSLATQTPATQTTGFTFGTATLASGGTGFSLGIGASKLNLSNTAATPAMANPSGFGLGSSNLTNAISSTVTSSQGTAPTGFVFGPST
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: RT-4 and Lane 2: U-251MG sp cell lysates with NUP62 polyclonal antibody (Cat # PAB30728).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with NUP62 polyclonal antibody (Cat # PAB30728) shows strong nuclear membrane and cytoplasmic positivity in neuronal cells.Immunofluorescence
Immunofluorescent staining of U-251 MG with NUP62 polyclonal antibody (Cat # PAB30728) (Green) shows positivity in nuclear membrane. -
Gene Info — NUP62
Entrez GeneID
23636Protein Accession#
P37198Gene Name
NUP62
Gene Alias
DKFZp547L134, FLJ20822, FLJ43869, IBSN, MGC841, SNDI, p62
Gene Description
nucleoporin 62kDa
Gene Ontology
HyperlinkGene Summary
The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins and is localized to the nuclear pore central plug. This protein associates with the importin alpha/beta complex which is involved in the import of proteins containing nuclear localization signals. Multiple transcript variants of this gene encode a single protein isoform. [provided by RefSeq
Other Designations
nuclear pore glycoprotein p62
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com