PRKAB1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with PRKAB1 polyclonal antibody (Cat # PAB30688).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human duodenum with PRKAB1 polyclonal antibody (Cat # PAB30688) shows strong cytoplasmic positivity in glandular cells.
Immunofluorescence
Immunofluorescent staining of U-251 MG with PRKAB1 polyclonal antibody (Cat # PAB30688) (Green) shows positivity in cytoplasm and nucleus but excluded from the nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human PRKAB1.
Immunogen
Recombinant protein corresponding to human PRKAB1.
Sequence
MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNW
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells) and Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) with PRKAB1 polyclonal antibody (Cat # PAB30688).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human duodenum with PRKAB1 polyclonal antibody (Cat # PAB30688) shows strong cytoplasmic positivity in glandular cells.Immunofluorescence
Immunofluorescent staining of U-251 MG with PRKAB1 polyclonal antibody (Cat # PAB30688) (Green) shows positivity in cytoplasm and nucleus but excluded from the nucleoli. -
Gene Info — PRKAB1
Entrez GeneID
5564Protein Accession#
Q9Y478Gene Name
PRKAB1
Gene Alias
AMPK, HAMPKb, MGC17785
Gene Description
protein kinase, AMP-activated, beta 1 non-catalytic subunit
Omim ID
602740Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex. [provided by RefSeq
Other Designations
5'-AMP-activated protein kinase beta-1 subunit|AMP-activated protein kinase beta 1 non-catalytic subunit|AMP-activated protein kinase beta subunit|AMPK beta -1 chain|AMPK beta 1|protein kinase, AMP-activated, noncatalytic, beta-1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com