PRKAG2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) and Lane 3: PC12 cell lysate (pheochromocytoma of rat adrenal medulla) with PRKAG2 polyclonal antibody (Cat # PAB30687).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human rectum with PRKAG2 polyclonal antibody (Cat # PAB30687) shows strong nuclear positivity in glandular cells.
Immunofluorescence
Immunofluorescent staining of U-2 OS with PRKAG2 polyclonal antibody (Cat # PAB30687) (Green) shows positivity in nucleus but excluded from the nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human PRKAG2.
Immunogen
Recombinant protein corresponding to human PRKAG2.
Sequence
STPTQVTKQHTFPLESYKHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEAGMLEKLEFEDEAVEDSESGVYMRFMRSHK
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: NIH-3T3 cell lysate (mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Wistar rat bladder tumor cells) and Lane 3: PC12 cell lysate (pheochromocytoma of rat adrenal medulla) with PRKAG2 polyclonal antibody (Cat # PAB30687).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human rectum with PRKAG2 polyclonal antibody (Cat # PAB30687) shows strong nuclear positivity in glandular cells.Immunofluorescence
Immunofluorescent staining of U-2 OS with PRKAG2 polyclonal antibody (Cat # PAB30687) (Green) shows positivity in nucleus but excluded from the nucleoli. -
Gene Info — PRKAG2
Entrez GeneID
51422Protein Accession#
Q9UGJ0Gene Name
PRKAG2
Gene Alias
AAKG, AAKG2, CMH6, H91620p, WPWS
Gene Description
protein kinase, AMP-activated, gamma 2 non-catalytic subunit
Gene Ontology
HyperlinkGene Summary
AMP-activated protein kinase (AMPK) is a heterotrimeric protein composed of a catalytic alpha subunit, a noncatalytic beta subunit, and a noncatalytic regulatory gamma subunit. Various forms of each of these subunits exist, encoded by different genes. AMPK is an important energy-sensing enzyme that monitors cellular energy status and functions by inactivating key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This gene is a member of the AMPK gamma subunit family and encodes a protein with four cystathionine beta-synthase domains. Mutations in this gene have been associated with ventricular pre-excitation (Wolff-Parkinson-White syndrome), progressive conduction system disease and cardiac hypertrophy. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
AMP-activated protein kinase gamma2 subunit|AMPK gamma2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com