NFKBIE polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western Blot analysis with NFKBIE polyclonal antibody (Cat # PAB30524)
Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG sp
Lane 3: Human plasma (IgG/HSA depleted)
Lane 4: Human liver tissue
Lane 5: Human tonsil tissue
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with NFKBIE polyclonal antibody (Cat # PAB30524) shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction center.
Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with NFKBIE polyclonal antibody (Cat # PAB30524) shows positivity in nucleus, nucleoli and cytoplasm. Antibody staining is shown in green.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human NFKBIE.
Immunogen
Recombinant protein corresponding to human NFKBIE.
Sequence
AEESQYDSGIESLRSLRSLPESTSAPASGPSDGSPQPCTHPPGPVKEPQEKEDADGERADSTYGSSSLTYTLSLLGGPEAEDPAPRLPLPHVGALSPQQLEALTYISEDGDTLVHLAVIHEAPAVLLCCLALLPQEVLDIQ
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western Blot analysis with NFKBIE polyclonal antibody (Cat # PAB30524)
Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG sp
Lane 3: Human plasma (IgG/HSA depleted)
Lane 4: Human liver tissue
Lane 5: Human tonsil tissueImmunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human lymph node with NFKBIE polyclonal antibody (Cat # PAB30524) shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction center.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with NFKBIE polyclonal antibody (Cat # PAB30524) shows positivity in nucleus, nucleoli and cytoplasm. Antibody staining is shown in green. -
Gene Info — NFKBIE
Entrez GeneID
4794Protein Accession#
O00221Gene Name
NFKBIE
Gene Alias
IKBE
Gene Description
nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, epsilon
Omim ID
604548Gene Ontology
HyperlinkGene Summary
NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008 or NFKBIB, MIM 604495), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664, or IKBKB, MIM 603258) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine). For some genes, activation requires NFKB interaction with other transcription factors, such as STAT (see STAT6, MIM 601512), AP1 (JUN, MIM 165160), and NFAT (see NFATC1, MIM 600489).[supplied by OMIM
Other Designations
OTTHUMP00000016522
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com