CELSR2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with CELSR2 polyclonal antibody (Cat # PAB30476) shows strong nuclear and cytoplasmic positivity in neuronal cells at 1:20-1:50 dilution.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human CELSR2.
Immunogen
Recombinant protein corresponding to human CELSR2.
Sequence
SATQDVHFTENLLRVGSALLDTANKRHWELIQQTEGGTAWLLQHYEAYASALAQNMRHTYLSPFTIVTPNIVISVVRLDKGNFAGAKLPRYEALRGEQPPDLETTVILPESVFRETPPVVRPAGPGEAQEPEELARRQRRHPELSQ
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with CELSR2 polyclonal antibody (Cat # PAB30476) shows strong nuclear and cytoplasmic positivity in neuronal cells at 1:20-1:50 dilution. -
Gene Info — CELSR2
Entrez GeneID
1952Protein Accession#
Q9HCU4Gene Name
CELSR2
Gene Alias
CDHF10, EGFL2, FLJ34118, FLJ42737, FLJ45143, FLJ45845, Flamingo1, KIAA0279, MEGF3
Gene Description
cadherin, EGF LAG seven-pass G-type receptor 2 (flamingo homolog, Drosophila)
Omim ID
604265Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the flamingo subfamily, part of the cadherin superfamily. The flamingo subfamily consists of nonclassic-type cadherins; a subpopulation that does not interact with catenins. The flamingo cadherins are located at the plasma membrane and have nine cadherin domains, seven epidermal growth factor-like repeats and two laminin A G-type repeats in their ectodomain. They also have seven transmembrane domains, a characteristic unique to this subfamily. It is postulated that these proteins are receptors involved in contact-mediated communication, with cadherin domains acting as homophilic binding regions and the EGF-like domains involved in cell adhesion and receptor-ligand interactions. The specific function of this particular member has not been determined. [provided by RefSeq
Other Designations
EGF-like-domain, multiple 2|OTTHUMP00000013794|cadherin EGF LAG seven-pass G-type receptor 2|epidermal growth factor-like 2|multiple epidermal growth factor-like domains 3
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com