HNRNPL polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human HNRNPL.
Immunogen
A synthetic peptide corresponding to N-terminus of human HNRNPL.
Sequence
DTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHD
Host
Rabbit
Theoretical MW (kDa)
65
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (2.5 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of HepG2 cell lysate with HNRNPL polyclonal antibody (Cat # PAB30141) at 2.5 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human liver with HNRNPL polyclonal antibody (Cat # PAB30141) at 4-8 ug/mL working concentration. -
Gene Info — HNRNPL
Entrez GeneID
3191GeneBank Accession#
NM_001533Protein Accession#
NP_001524;P14866Gene Name
HNRNPL
Gene Alias
FLJ35509, HNRPL, P/OKcl.14, hnRNP-L
Gene Description
heterogeneous nuclear ribonucleoprotein L
Omim ID
603083Gene Ontology
HyperlinkGene Summary
Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (hnRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are stably associated with hnRNP complexes and along with other hnRNP proteins is likely to play a major role in the formation, packaging, processing, and function of mRNA. Heterogeneous nuclear ribonucleoprotein L is present in the nucleoplasm as part of the HNRP complex. HNRP proteins have also been identified outside of the nucleoplasm. Exchange of hnRNP for mRNA-binding proteins accompanies transport of mRNA from the nucleus to the cytoplasm. Since HNRP proteins have been shown to shuttle between the nucleus and the cytoplasm, it is possible that they also have cytoplasmic functions. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com