CPNE1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of (1) HepG2, (2) MCF7, (3) HeLa, and (4) HEK293 cell lysate with CPNE1 polyclonal antibody (Cat # PAB30007) at 2 ug/mL working concentration.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human intestine with CPNE1 polyclonal antibody (Cat # PAB30007) at 4-8 ug/mL working concentration.
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human CPNE1.
Immunogen
A synthetic peptide corresponding to N-terminus of human CPNE1.
Sequence
TVQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPG
Host
Rabbit
Theoretical MW (kDa)
59
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (5 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of (1) HepG2, (2) MCF7, (3) HeLa, and (4) HEK293 cell lysate with CPNE1 polyclonal antibody (Cat # PAB30007) at 2 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human intestine with CPNE1 polyclonal antibody (Cat # PAB30007) at 4-8 ug/mL working concentration. -
Gene Info — CPNE1
Entrez GeneID
8904GeneBank Accession#
NM_003915Protein Accession#
NP_003906;Q99829Gene Name
CPNE1
Gene Alias
COPN1, CPN1, MGC1142
Gene Description
copine I
Omim ID
604205Gene Ontology
HyperlinkGene Summary
Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Alternate splicing results in multiple transcript variants encoding different proteins. [provided by RefSeq
Other Designations
OTTHUMP00000030775|OTTHUMP00000030776|copine-1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com