HNRNPH1 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against synthetic peptide of human HNRNPH1.
Immunogen
A synthetic peptide corresponding to internal region of human HNRNPH1.
Sequence
FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG
Host
Rabbit
Theoretical MW (kDa)
49
Reactivity
Human
Form
Liquid
Purification
Affinity purification
Recommend Usage
Immunofluorescence (1:200)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (5 ug/mL)
Immunoprecipitation (1:4000)
Western Blot
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (2% sucrose, 0.09% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of HepG2 cell lysate with HNRNPH1 polyclonal antibody (Cat # PAB29941) at 0.2-1 ug/mL working concentration.Western Blot (Cell lysate)
Western Blot analysis of Jurkat cell lysate with HNRNPH1 polyclonal antibody (Cat # PAB29941) at 1 ug/mL working concentration.Western Blot (Cell lysate)
Western Blot analysis of MCF7 cell lysate with HNRNPH1 polyclonal antibody (Cat # PAB29941) at 1 ug/mL working concentration.Western Blot (Cell lysate)
Western Blot analysis of Lane 1: 20 ug HeLa S3 cell lysate, Lane 2: 20 ug MCF7 cell lysate and Lane 3: 20 ug K562 cell lysate with HNRNPH1 polyclonal antibody (Cat # PAB29941) at 1:4000 dilution.Western Blot (Cell lysate)
Western Blot analysis of 721 B lymphoblast cell lysate with HNRNPH1 polyclonal antibody (Cat # PAB29941) at 1 ug/mL working concentration.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with HNRNPH1 polyclonal antibody (Cat # PAB29941) at 5 ug/mL working concentration.Immunofluorescence
Immunofluorescent staining of MCF7 cells with HNRNPH1 polyclonal antibody (Cat # PAB29941) at 1:200 dilution.Immunoprecipitation
Immunoprecipitation of Lane 1: 5% Input, Lane 2: 5% Sup, Lane 3: Normal IgG and Lane 4: hn-RNPH1 ppt. k562 sample with HNRNPH1 polyclonal antibody (Cat # PAB29941) at 1:4000 dilution. -
Gene Info — HNRNPH1
Entrez GeneID
3187GeneBank Accession#
NM_005520Protein Accession#
NP_005511;P31943Gene Name
HNRNPH1
Gene Alias
DKFZp686A15170, HNRPH, HNRPH1, hnRNPH
Gene Description
heterogeneous nuclear ribonucleoprotein H1 (H)
Omim ID
601035Gene Ontology
HyperlinkGene Summary
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs. It is very similar to the family member HNRPF. This gene is thought to be potentially involved in hereditary lymphedema type I phenotype. [provided by RefSeq
Other Designations
OTTHUMP00000161513|heterogeneous nuclear ribonucleoprotein H1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com