USP14 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with USP14 polyclonal antibody (Cat # PAB29362) at 1:100-1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human pancreas with USP14 polyclonal antibody (Cat # PAB29362) shows strong cytoplasmic positivity in exocrine glandular cells at 1:500-1:1000 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with USP14 polyclonal antibody (Cat # PAB29362) at 1-4 ug/mL concentration shows positivity in cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human USP14.
Immunogen
Recombinant protein corresponding to human USP14.
Sequence
EKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVL
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with USP14 polyclonal antibody (Cat # PAB29362) at 1:100-1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human pancreas with USP14 polyclonal antibody (Cat # PAB29362) shows strong cytoplasmic positivity in exocrine glandular cells at 1:500-1:1000 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-251 MG with USP14 polyclonal antibody (Cat # PAB29362) at 1-4 ug/mL concentration shows positivity in cytoplasm. -
Gene Info — USP14
Entrez GeneID
9097Gene Name
USP14
Gene Alias
TGT
Gene Description
ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase)
Omim ID
607274Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. Mice with a mutation that results in reduced expression of the ortholog of this protein are retarded for growth, develop severe tremors by 2 to 3 weeks of age followed by hindlimb paralysis and death by 6 to 10 weeks of age. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
deubiquitinating enzyme 14|tRNA-guanine transglycosylase, 60-kD subunit|ubiquitin carboxyl-terminal hydrolase 14|ubiquitin specific protease 14|ubiquitin specific protease 14 (tRNA-guanine transglycosylase)|ubiquitin thiolesterase 14|ubiquitin-specific pr
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com