RPS25 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with RPS25 polyclonal antibody (Cat # PAB28270) at 1:100 - 1:250 dilution.
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with RPS25 polyclonal antibody (Cat # PAB28270) at 1:100 - 1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human colon with RPS25 polyclonal antibody (Cat # PAB28270) shows strong cytoplasmic positivity in glandular cells at 1:50-1:200 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with RPS25 polyclonal antibody (Cat # PAB28270) at 1-4 ug/ml shows positivity in cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant RPS25.
Immunogen
Recombinant protein corresponding to amino acids of recombinant RPS25.
Sequence
VPNYKLITPAVVSERLKIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNTKGGDAPAAGEDA
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with RPS25 polyclonal antibody (Cat # PAB28270) at 1:100 - 1:250 dilution.Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with RPS25 polyclonal antibody (Cat # PAB28270) at 1:100 - 1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human colon with RPS25 polyclonal antibody (Cat # PAB28270) shows strong cytoplasmic positivity in glandular cells at 1:50-1:200 dilution.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with RPS25 polyclonal antibody (Cat # PAB28270) at 1-4 ug/ml shows positivity in cytoplasm. -
Gene Info — RPS25
Entrez GeneID
6230Gene Name
RPS25
Gene Alias
-
Gene Description
ribosomal protein S25
Omim ID
180465Gene Ontology
HyperlinkGene Summary
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S25E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq
Other Designations
40S ribosomal protein S25
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com