KCNV2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human pancreas with KCNV2 polyclonal antibody (Cat # PAB22517) shows strong granular cytoplasmic positivity in exocrine glandular cells at 1:50-1:200 dilution.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant KCNV2.
Immunogen
Recombinant protein corresponding to amino acids of human KCNV2.
Sequence
WNTTENEGSQHRRSICSLGARSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAKPEGPSDPPALLSTLNVNVGGHSYQLDYCELA
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human pancreas with KCNV2 polyclonal antibody (Cat # PAB22517) shows strong granular cytoplasmic positivity in exocrine glandular cells at 1:50-1:200 dilution. -
Gene Info — KCNV2
Entrez GeneID
169522Protein Accession#
Q8TDN2Gene Name
KCNV2
Gene Alias
KV11.1, Kv8.2, MGC120515, RCD3B
Gene Description
potassium channel, subfamily V, member 2
Omim ID
607604Gene Ontology
HyperlinkGene Summary
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium voltage-gated channel subfamily V. This member is identified as a 'silent subunit', and it does not form homomultimers, but forms heteromultimers with several other subfamily members. Through obligatory heteromerization, it exerts a function-altering effect on other potassium channel subunits. This protein is strongly expressed in pancreas and has a weaker expression in several other tissues. [provided by RefSeq
Other Designations
OTTHUMP00000020986|voltage-gated potassium channel Kv8.2
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com