SLC25A22 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of cell lysates with SLC25A22 polyclonal antibody (Cat # PAB21935) at 1:250-1:500 dilution.
Lane 1 : NIH/3T3
Lane 2 : NBT-II
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with SLC25A22 polyclonal antibody (Cat # PAB21935) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human prostate with SLC25A22 polyclonal antibody (Cat # PAB21935) strong cytoplasmic positivity in glandular cells at 1:50-1:200 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with SLC25A22 polyclonal antibody (Cat # PAB21935) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli and mitochondria.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant SLC25A22.
Immunogen
Recombinant protein corresponding to amino acids of human SLC25A22.
Sequence
RSEGYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIVTTPMEMLKIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVE
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of cell lysates with SLC25A22 polyclonal antibody (Cat # PAB21935) at 1:250-1:500 dilution.
Lane 1 : NIH/3T3
Lane 2 : NBT-IIWestern Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with SLC25A22 polyclonal antibody (Cat # PAB21935) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human prostate with SLC25A22 polyclonal antibody (Cat # PAB21935) strong cytoplasmic positivity in glandular cells at 1:50-1:200 dilution.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with SLC25A22 polyclonal antibody (Cat # PAB21935) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli and mitochondria. -
Gene Info — SLC25A22
Entrez GeneID
79751Protein Accession#
Q9H936Gene Name
SLC25A22
Gene Alias
FLJ13044, GC1
Gene Description
solute carrier family 25 (mitochondrial carrier: glutamate), member 22
Gene Ontology
HyperlinkGene Summary
The SLC25 gene family encodes mitochondrial carriers that transport a variety of metabolites across the inner mitochondrial membrane (Palmieri, 2004 [PubMed 14598172]). SLC25A22, also known as GC1, is 1 of the 2 mitochondrial glutamate/H+ symporters, the other being SLC25A18 (MIM 609303).[supplied by OMIM
Other Designations
mitochondrial glutamate carrier 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com