UBE3D polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with UBE3D polyclonal antibody (Cat # PAB21883) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human heart muscle with UBE3D polyclonal antibody (Cat # PAB21883) shows strong cytoplasmic positivity in myocytes at 1:20-1:50 dilution.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant UBE3D.
Immunogen
Recombinant protein corresponding to amino acids of human UBE3D.
Sequence
SLVIESLRNSKYIKKFPLLENTFKADSSSAWSAVKVLYQPCIKSRNEKLVSLWESDISVHPLTLPSATCLELLL
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with UBE3D polyclonal antibody (Cat # PAB21883) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human heart muscle with UBE3D polyclonal antibody (Cat # PAB21883) shows strong cytoplasmic positivity in myocytes at 1:20-1:50 dilution. -
Gene Info — UBE3D
Entrez GeneID
90025Protein Accession#
Q7Z6J8Gene Name
UBE3D
Gene Alias
RP4-751H9.1, C6orf157, H10BH, UBE2CBP, YJR141W
Gene Description
ubiquitin protein ligase E3D
Gene Ontology
HyperlinkOther Designations
E3 ubiquitin-protein ligase E3D; UBCH10 binding protein with a hect-like domain; ubcH10-binding protein with a HECT-like domain; ubiquitin-conjugating enzyme E2C binding protein; ubiquitin-conjugating enzyme E2C-binding protein
-
Interactome
-
Publication Reference
-
UBE3D Is Involved in Blue Light-Induced Retinal Damage by Regulating Double-Strand Break Repair.
Ningda Xu, Yue Liu, Shanshan Nai, Yong Tao, Yuehe Ding, Lemei Jia, Qizhi Geng, Jie Li, Yujing Bai, Gong-Hong Wei, Meng-Qiu Dong, Linyi Luo, Mingwei Zhao, Xingzhi Xu, Xiao-Xin Li, Jing Li, and Lvzhen Huang.
Investigative Ophthalmology & Visual Science 2022 Sep; 63(10):7.
Application：WB, Human, HeLa cells.
-
Targeting the mRNA endonuclease CPSF73 inhibits breast cancer cell migration, invasion, and self-renewal.
Huiyun Liu, Daniel Heller-Trulli, Claire L Moore.
iScience 2022 Aug; 25(8):104804.
Application：WB-Tr, Human, HEK293T cells.
-
ube3d, a New Gene Associated with Age-Related Macular Degeneration, Induces Functional Changes in Both In Vivo and In Vitro Studies.
Xia H, Zhang Q, Shen Y, Bai Y, Ma X, Zhang B, Qi Y, Zhang J, Hu Q, Du W, Zhu L, Zhou P, Wang B, Xu H, Huang L, Li X.
Molecular Therapy. Nucleic Acids 2020 Jun; 20:217.
Application：WB-Tr, Human, hRPE cells.
-
UBE3D Is Involved in Blue Light-Induced Retinal Damage by Regulating Double-Strand Break Repair.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com