SNRNP40 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with SNRNP40 polyclonal antibody (Cat # PAB21803) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human stomach with SNRNP40 polyclonal antibody (Cat # PAB21803) shows strong nuclear positivity in glandular cells at 1:50-1:200 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with SNRNP40 polyclonal antibody (Cat # PAB21803) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant SNRNP40.
Immunogen
Recombinant protein corresponding to amino acids of human SNRNP40.
Sequence
QGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with SNRNP40 polyclonal antibody (Cat # PAB21803) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human stomach with SNRNP40 polyclonal antibody (Cat # PAB21803) shows strong nuclear positivity in glandular cells at 1:50-1:200 dilution.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with SNRNP40 polyclonal antibody (Cat # PAB21803) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli. -
Gene Info — SNRNP40
Entrez GeneID
9410Protein Accession#
Q96DI7Gene Name
SNRNP40
Gene Alias
40K, FLJ41108, HPRP8BP, MGC1910, PRP8BP, PRPF8BP, RP11-490K7.3, SPF38, WDR57
Gene Description
small nuclear ribonucleoprotein 40kDa (U5)
Omim ID
607797Gene Ontology
HyperlinkGene Summary
This gene encodes a component of the U5 small nuclear ribonucleoprotein (snRNP) particle. The U5 snRNP is part of the spliceosome, a multiprotein complex that catalyzes the removal of introns from pre-messenger RNAs. [provided by RefSeq
Other Designations
38 kDa-splicing factor|OTTHUMP00000003888|Prp8-binding protein|U5 snRNP-specific 40 kDa protein (hPrp8-binding)|U5-40kD protein|WD repeat domain 57 (U5 snRNP specific)
-
Interactome
-
Publication Reference
-
Deregulated Splicing Is a Major Mechanism of RNA-Induced Toxicity in Huntington's Disease.
Schilling J, Broemer M, Atanassov I, Duernberger Y, Vorberg I, Dieterich C, Dagane A, Dittmar G, Wanker E, van Roon-Mom W, Winter J, Krauß S.
Journal of Molecular Biology 2019 Apr; 431(9):1869.
Application：WB, Human, SH-SY5Y cells.
-
Deregulated Splicing Is a Major Mechanism of RNA-Induced Toxicity in Huntington's Disease.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com