Ppfia3 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant Ppfia3.
Immunogen
Recombinant GST fusion protein corresponding to 151 mouse Ppfia3.
Sequence
DKTNHVSKEEAGVPRGEGPAVPGDTPPPTPRSARLERMAQALALQAGSPEDGAPPRGSESTPDSLHKAPKRKSIKSSIGRLFGKKEKGRMGPPGRESVSLAGTPSDETLATDPLGLAKLTGPGDKDRRNKRKHELLEEACRQGLPFAAWDG
Host
Rabbit
Reactivity
Mouse
Specificity
Specific to recombinant protein GX1885. This antibody detects endogenous mPPFIA3 protein in several cell types.
Form
Liquid
Recommend Usage
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS (50% glycerol, 0.02% sodium azide)
Storage Instruction
Store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
-
Gene Info — Ppfia3
Entrez GeneID
76787Protein Accession#
AB014554 (Human)Gene Name
Ppfia3
Gene Alias
2410127E16Rik
Gene Description
protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3
Gene Ontology
HyperlinkGene Summary
Ppfia3
Other Designations
-
-
Publication Reference
-
A comprehensive approach for establishment of the platform to analyze functions of KIAA proteins II: public release of inaugural version of InGaP database containing gene/protein expression profiles for 127 mouse KIAA genes/proteins.
Hisashi Koga, Shigeki Yuasa, Takahiro Nagase, Kiyo Shimada, Mihoko Nagano, Kazuhide Imai, Reiko Ohara, Daisuke Nakajima, Masatoshi Murakami, Makoto Kawai, Futaba Miki, Junji Magae, Susumu Inamoto, Noriko Okazaki, Osamu Ohara.
DNA Research 2004 Aug; 11(4):293.
-
High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.
Hara Y, Shimada K, Kohga H, Ohara O, Koga H.
DNA Research 2003 Jun; 10(3):129.
-
Liprins, a family of LAR transmembrane protein-tyrosine phosphatase-interacting proteins.
Serra-Pages C, Medley QG, Tang M, Hart A, Streuli M.
The Journal of Biological Chemistry 1998 Jun; 273(25):15611.
-
A comprehensive approach for establishment of the platform to analyze functions of KIAA proteins II: public release of inaugural version of InGaP database containing gene/protein expression profiles for 127 mouse KIAA genes/proteins.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com