BTN2A1 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Surface Plasmon Resonance
Human BTN2A1, His Tag immobilized on CM5 Chip can bind Human CD209, His Tag with an affinity constant of 0.12 uM as determined in SPR assay (Biacore T200).
SEC-HPLC
The purity of Human BTN2A1 is greater than 95% as determined by SEC-HPLC.
Tris-Bis PAGE
Human BTN2A1 on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.
-
Specification
Product Description
Human BTN2A1 (Q7KYR7-1, 29 a.a. - 248 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
Sequence
QFIVVGPTDPILATVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTVWRDPYGGVAPALKEVSMPDADGLFMVTTAVIIRDKSVRNMSCSINNTLLGQKKESVIFIPESFMPSVSPLA
Host
Human
Theoretical MW (kDa)
25.65
Form
Lyophilized
Preparation Method
Mammalian cell (Expi293, high-yield transient HEK293) expression system
Purity
> 95% as determined by Tris-Bis PAGE; > 95% as determined by HPLC
Endotoxin Level
< 1 EU per 1 ug of protein (determined by LAL method)
Activity
The affinity constant of 0.12 uM as determined in SPR assay (Biacore T200). See testing image for detail.
Quality Control Testing
SEC-HPLC and Tris-Bis PAGE
SEC-HPLC
The purity of Human BTN2A1 is greater than 95% as determined by SEC-HPLC.
Tris-Bis PAGE
Human BTN2A1 on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.
Recommend Usage
Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.Storage Buffer
Lyophilized from sterile distilled Water is > 100 ug/mL
Storage Instruction
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
Aliquot to avoid repeated freezing and thawing.Note
Result of bioactivity analysis
-
Applications
Functional Study
SDS-PAGE
Surface Plasmon Resonance
Human BTN2A1, His Tag immobilized on CM5 Chip can bind Human CD209, His Tag with an affinity constant of 0.12 uM as determined in SPR assay (Biacore T200). -
Gene Info — BTN2A1
Entrez GeneID
11120Protein Accession#
Q7KYR7-1Gene Name
BTN2A1
Gene Alias
BK14H9.1, BT2.1, BTF1, DJ3E1.1, FLJ36567
Gene Description
butyrophilin, subfamily 2, member A1
Gene Ontology
HyperlinkGene Summary
This gene is a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin protein family. The gene is located in a cluster on chromosome 6, consisting of seven genes belonging to the expanding B7/butyrophilin-like group, a subset of the immunoglobulin gene superfamily. The encoded protein is an integral plasma membrane B box protein involved in lipid, fatty-acid and sterol metabolism. [provided by RefSeq
Other Designations
butyrophilin BTF1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com