F3 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Enzyme-linked Immunoabsorbent Assay
Immobilized Human Coagulation Factor III, His Tag at 2 ug/mL (100 uL/well) on the plate. Dose response curve for Anti-Coagulation Factor III Antibody, hFc Tag with the EC50 of 8.8 ng/mL determined by ELISA.
Tris-Bis PAGE
Human Coagulation Factor III on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.
-
Specification
Product Description
Human F3 (P13726-1, 33 a.a. - 251 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
Sequence
SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE
Host
Human
Theoretical MW (kDa)
25.89
Form
Lyophilized
Preparation Method
Mammalian cell (Expi293, high-yield transient HEK293) expression system
Purity
> 95% as determined by Tris-Bis PAGE; > 95% as determined by HPLC
Endotoxin Level
< 1 EU per 1 ug of protein (determined by LAL method)
Activity
The EC50 was 8.8 ng/mL, messured by ELISA at 2 ug/mL.
Quality Control Testing
SEC-HPLC and Tris-Bis PAGE
Tris-Bis PAGE
Human Coagulation Factor III on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.
Recommend Usage
Biological Activity
ELISA
SDS-PAGE
The optimal working dilution should be determined by the end user.Storage Buffer
Lyophilized from sterile distilled Water is > 100 ug/mL
Storage Instruction
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
Aliquot to avoid repeated freezing and thawing.Note
Result of bioactivity analysis
-
Applications
Enzyme-linked Immunoabsorbent Assay
Immobilized Human Coagulation Factor III, His Tag at 2 ug/mL (100 uL/well) on the plate. Dose response curve for Anti-Coagulation Factor III Antibody, hFc Tag with the EC50 of 8.8 ng/mL determined by ELISA.Functional Study
SDS-PAGE
-
Gene Info — F3
Entrez GeneID
2152Protein Accession#
P13726-1Gene Name
F3
Gene Alias
CD142, TF, TFA
Gene Description
coagulation factor III (thromboplastin, tissue factor)
Omim ID
134390Gene Ontology
HyperlinkGene Summary
This gene encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. [provided by RefSeq
Other Designations
OTTHUMP00000012426|coagulation factor III|tissue factor
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com