IL21R (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Enzyme-linked Immunoabsorbent Assay
Immobilized Human IL-21 at 1 ug/mL(100 uL/well) on the plate. Dose response curve for Human IL-21R, His Tag with the EC50 of 24.3 ng/mL determined by ELISA.
SEC-HPLC
Human IL-21R on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.
Tris-Bis PAGE
Human IL-21R on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.
-
Specification
Product Description
Human IL21R (Q9HBE5, 20 a.a. - 232 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
Sequence
CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKE
Host
Human
Theoretical MW (kDa)
25.65
Form
Lyophilized
Preparation Method
Mammalian cell (Expi293, high-yield transient HEK293) expression system
Purity
> 95% as determined by Tris-Bis PAGE; > 95% as determined by HPLC
Endotoxin Level
< 1 EU per 1 ug of protein (determined by LAL method)
Activity
The EC50 was 24.3 ng/mL, messured by ELISA at 1 ug/mL.
Quality Control Testing
SEC-HPLC and Tris-Bis PAGE
SEC-HPLC
Human IL-21R on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.
Tris-Bis PAGE
Human IL-21R on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.
Recommend Usage
Biological Activity
ELISA
SDS-PAGE
The optimal working dilution should be determined by the end user.Storage Buffer
Lyophilized from sterile distilled Water is > 100 ug/mL
Storage Instruction
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
Aliquot to avoid repeated freezing and thawing.Note
Result of bioactivity analysis
-
Applications
Enzyme-linked Immunoabsorbent Assay
Immobilized Human IL-21 at 1 ug/mL(100 uL/well) on the plate. Dose response curve for Human IL-21R, His Tag with the EC50 of 24.3 ng/mL determined by ELISA.Functional Study
SDS-PAGE
-
Gene Info — IL21R
Entrez GeneID
50615Protein Accession#
Q9HBE5Gene Name
IL21R
Gene Alias
MGC10967, NILR
Gene Description
interleukin 21 receptor
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytokine receptor for interleukin 21 (IL21). It belongs to the type I cytokine receptors, and has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the receptors for interleukin 2, 4, 7, 9, and 15. This receptor transduces the growth promoting signal of IL21, and is important for the proliferation and differentiation of T cells, B cells, and natural killer (NK) cells. The ligand binding of this receptor leads to the activation of multiple downstream signaling molecules, including JAK1, JAK3, STAT1, and STAT3. Knockout studies of a similar gene in mouse suggest a role for this gene in regulating immunoglobulin production. Three alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com