CCR8 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Enzyme-linked Immunoabsorbent Assay
Immobilized Human CCR8, mFc Tag at 0.5 ug/mL (100 uL/well) on the plate. Dose response curve for Anti-CCR8 Antibody, hFc Tag with the EC50 of 28.9 ng/mL determined by ELISA.
SEC-HPLC
The purity of Human CCR8 is greater than 95% as determined by SEC-HPLC.
Tris-Bis PAGE
Human CCR8 on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.
-
Specification
Product Description
Human CCR8 (P51685-1, 1 a.a. - 35 a.a.) partial recombinant protein with mFc tag at C-terminus expressed in HEK293 cells.
Sequence
MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGK
Host
Human
Theoretical MW (kDa)
30.25
Form
Lyophilized
Preparation Method
Mammalian cell (Expi293, high-yield transient HEK293) expression system
Purity
> 95% as determined by Tris-Bis PAGE; > 95% as determined by HPLC
Endotoxin Level
< 1 EU per 1 ug of protein (determined by LAL method)
Activity
The EC50 was 28.9 ng/mL, messured by ELISA at 0.5 ug/mL.
Quality Control Testing
SEC-HPLC and Tris-Bis PAGE
SEC-HPLC
The purity of Human CCR8 is greater than 95% as determined by SEC-HPLC.
Tris-Bis PAGE
Human CCR8 on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.
Recommend Usage
Biological Activity
ELISA
SDS-PAGE
The optimal working dilution should be determined by the end user.Storage Buffer
Lyophilized from sterile distilled Water is > 100 ug/mL
Storage Instruction
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
Aliquot to avoid repeated freezing and thawing.Note
Result of bioactivity analysis
-
Applications
Enzyme-linked Immunoabsorbent Assay
Immobilized Human CCR8, mFc Tag at 0.5 ug/mL (100 uL/well) on the plate. Dose response curve for Anti-CCR8 Antibody, hFc Tag with the EC50 of 28.9 ng/mL determined by ELISA.Functional Study
SDS-PAGE
-
Gene Info — CCR8
Entrez GeneID
1237Protein Accession#
P51685-1Gene Name
CCR8
Gene Alias
CDw198, CKR-L1, CKRL1, CMKBR8, CMKBRL2, CY6, GPR-CY6, MGC129966, MGC129973, TER1
Gene Description
chemokine (C-C motif) receptor 8
Omim ID
601834Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptors are important for the migration of various cell types into the inflammatory sites. This receptor protein preferentially expresses in the thymus. I-309, thymus activation-regulated cytokine (TARC) and macrophage inflammatory protein-1 beta (MIP-1 beta) have been identified as ligands of this receptor. Studies of this receptor and its ligands suggested its role in regulation of monocyte chemotaxis and thymic cell apoptosis. More specifically, this receptor may contribute to the proper positioning of activated T cells within the antigenic challenge sites and specialized areas of lymphoid tissues. This gene is located at the chemokine receptor gene cluster region. [provided by RefSeq
Other Designations
CC chemokine receptor 8|CC-chemokine receptor chemr1|chemokine (C-C) receptor 8|chemokine (C-C) receptor-like 2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com