MICA (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Enzyme-linked Immunoabsorbent Assay
Immobilized Human MICA, hFc Tag at 2 ug/mL (100 uL/Well) on the plate. Dose response curve for Biotinylated Anti-MICA Antibody, hFc Tag with the EC50 of 0.45 ug/mL determined by ELISA (QC Test).
Surface Plasmon Resonance
Human MICA, hFc Tag captured on CM5 Chip via Protein A can bind Human NKG2D, His Tag with an affinity constant of 0.36 uM as determined in SPR assay Biacore T200).
SEC-HPLC
The purity of Human MICA is greater than 95% as determined by SEC-HPLC.
Tris-Bis PAGE
Human MICA on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.
-
Specification
Product Description
Human MICA (Q96QC4, 24 a.a. - 308 a.a.) partial recombinant protein with hFc tag at C-terminus expressed in HEK293 cells.
Sequence
EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ
Host
Human
Theoretical MW (kDa)
59.64
Form
Liquid
Preparation Method
Mammalian cell (Expi293, high-yield transient HEK293) expression system
Purity
> 95% as determined by Tris-Bis PAGE; > 95% as determined by HPLC
Endotoxin Level
< 1 EU per 1 ug of protein (determined by LAL method)
Activity
The EC50 was 0.45 ug/mL, messured by ELISA at 2 ug/mL.
Quality Control Testing
SEC-HPLC and Tris-Bis PAGE
SEC-HPLC
The purity of Human MICA is greater than 95% as determined by SEC-HPLC.
Tris-Bis PAGE
Human MICA on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.
Recommend Usage
Biological Activity
ELISA
SDS-PAGE
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS pH 7.4
Storage Instruction
Store at -80°C for 12 Month.
Aliquot to avoid repeated freezing and thawing.Note
Result of bioactivity analysis
-
Applications
Enzyme-linked Immunoabsorbent Assay
Immobilized Human MICA, hFc Tag at 2 ug/mL (100 uL/Well) on the plate. Dose response curve for Biotinylated Anti-MICA Antibody, hFc Tag with the EC50 of 0.45 ug/mL determined by ELISA (QC Test).Functional Study
SDS-PAGE
Surface Plasmon Resonance
Human MICA, hFc Tag captured on CM5 Chip via Protein A can bind Human NKG2D, His Tag with an affinity constant of 0.36 uM as determined in SPR assay Biacore T200).
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com